missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARL4C Full-length ORF (NP_005728.2, 1 a.a. - 192 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010123-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134522

  • 5420.23 NOK / 25µg

Estimated Shipment: 29-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

ADP-ribosylation factor-like 4C is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4C is closely similar to ARL4A and ARL4D and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [provided by RefSeq]

Sequence: MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAKGISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGTPLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMILKRRKSLKQKKKR
Specifications

Specifications

NP_005728.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
47.9kDa
Glutathione Sepharose 4 Fast Flow
25 ug
RUO
ARL4C
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10123
ARL4C (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARL7/LAK
ARL4C
Yes
Videos
SDS
Documents
Certificates