missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human APOH Partial ORF (NP_000033, 236 a.a. - 345 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000350-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16191721

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeq]

Sequence: DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Specifications

Specifications

NP_000033
Liquid
350
APOH (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
B2G1/BG
APOH
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
RUO
APOH
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers