missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AKR1CL1 Full-length ORF (NP_001007537.1, 1 a.a. - 129 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00340811-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16190204

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKSQAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWEKIADGTVKREEIFYTIKLWATFFRAELVHPALERSLKKLGPDYVDLFIIHVPFAMKGSS
Specifications

Specifications

NP_001007537.1
Liquid
340811
AKR1CL1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ16347
AKR1CL1
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
41kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
AKR1CL1
Wheat Germ (in vitro)
GST
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers