missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AKAP13 Partial ORF (NP_006729, 1 a.a. - 110 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00011214-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136382

  • 3602.46 NOK / 10µg

Estimated Shipment: 19-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternative splicing of this gene results in at least 3 transcript variants encoding different isoforms containing a dbl oncogene homology (DH) domain and a pleckstrin homology (PH) domain. The DH domain is associated with guanine nucleotide exchange activation for the Rho/Rac family of small GTP binding proteins, resulting in the conversion of the inactive GTPase to the active form capable of transducing signals. The PH domain has multiple functions. Therefore, these isoforms function as scaffolding proteins to coordinate a Rho signaling pathway and, in addition, function as protein kinase A-anchoring proteins. [provided by RefSeq]

Sequence: MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
Specifications

Specifications

NP_006729
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MKLNPQQAPLYGDCVVTVLLAEEDKAEDDVVFYLVFLGSTLRHCTSTRKVSSDTLETIAPGHDCCETVKVQLCASKEGLPVFVVAEEDFHFVQDEAYDAAQFLATSAGNQ
RUO
AKAP13
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
11214
AKAP13 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AKAP-Lbc/ARHGEF13/BRX/FLJ11952/FLJ43341/HA-3/Ht31/LBC/PROTO-LB/PROTO-LBC/c-lbc
AKAP13
Yes
Videos
SDS
Documents
Certificates