missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AK2 Partial ORF (NP_001616.1, 1 a.a. - 96 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000204-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134484

  • 3602.46 NOK / 10µg

Estimated Shipment: 29-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGF
Specifications

Specifications

NP_001616.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.3kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGF
RUO
AK2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
204
AK2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ADK2
AK2
Yes
Videos
SDS
Documents
Certificates