missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ADORA3 Partial ORF (AAH29831, 121 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000140-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16141301

  • 5420.23 NOK / 25µg

Estimated Shipment: 23-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
Specifications

Specifications

AAH29831
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.18kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYFSFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGRE
RUO
ADORA3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
140
ADORA3 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
A3AR/AD026/bA552M11.5
ADORA3
Yes
Videos
SDS
Documents
Certificates