missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HSPE1 (Human) Recombinant Protein
Human HSPE1 full-length ORF ( AAH23518, 1 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00003336-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Specifications
| AAH23518 | |
| heat shock 10kDa protein 1 (chaperonin 10) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HSPE1 | |
| GST |
| 3336 | |
| Wheat germ expression system | |
| 10 μg | |
| CPN10, GROES, HSP10 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |