missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HOXB13 (Human) Recombinant Protein

Human HOXB13 partial ORF (AAH07092.1, 61 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00010481-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135182

  • 6270.00 NOK / 25µg
Estimated Shipment: 15-11-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: KQCHPCPGVPQGTSPAPVPYGYFGGGYYSCRVSRSSLKPCAQAATLAAYPAETPTAGEEYPSRPTEFAFYPGYPGTYQPMASYLDVSVVQTLGAPGEPRHDSLLPVDSYQSWALAGGWNSQMCCQGEQNPPGPFWKAAFADSSGQHPPDACAFRRG
Specifications

Specifications

AAH07092.1
homeobox B13
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HOXB13
GST
10481
Wheat germ expression system
25 μg
PSGD
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers