missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HMGN4 Recombinant Protein

Name: Abnova&trade; HMGN4 Recombinant Protein
Brand: Abnova&trade;
SKU: 16125162
Price: 3655.00 EUR

Brand: Abnova™ H00010473-P01.10ug

Additional Details : Weight : 0.00010kg

Product Code. 16125162

Estimated Shipment: 16-05-2023
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH01282
Format	Solution
Gene ID (Entrez)	10473
Name	HMGN4 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	HMGN4
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	35.64
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK
Gene Alias	HMG17L3/MGC5145/NHC
Gene Symbol	HMGN4
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description