missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HMGN1 (Human) Recombinant Protein
Human HMGN1 full-length ORF ( AAH23984, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00003150-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
Specifications
| AAH23984 | |
| high-mobility group nucleosome binding domain 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| HMGN1 | |
| GST |
| 3150 | |
| Wheat germ expression system | |
| 25 μg | |
| FLJ27265, FLJ31471, HMG14, MGC104230, MGC117425 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |