missing translation for 'onlineSavingsMsg'
Learn More

HLA A Antibody [DyLight 594], Novus Biologicals Biologicals™

Product Code. 30498075 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498075 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498075 Supplier Novus Biologicals Supplier No. NBP337966DL594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

HLA A Polyclonal antibody specifically detects HLA A in Human,Mouse samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen HLA A
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate DyLight 594
Formulation 50mM Sodium Borate
Gene Alias A-10 alpha chain, FLJ26655, HLA class I histocompatibility antigen, A-1 alpha chain, HLA class I histocompatibility antigen, A-28 alpha chain, HLA class I histocompatibility antigen, A-9 alpha chain, HLAA, major histocompatibility complex, class I, A, MHC class I antigen A*1, MHC class I antigen A*11, MHC class I antigen A*80
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 35-285 of human HLA A (NP_002107.3).,, Sequence:, GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIAL
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Adaptive Immunity, Cell Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 3105
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.