missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HEY1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
1715.00 NOK - 4975.00 NOK
Specifications
| Antigen | HEY1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226628
|
Novus Biologicals
NBP3-35645-100ul |
100 μL |
4975.00 NOK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227651
|
Novus Biologicals
NBP3-35645-20ul |
20 μL |
1715.00 NOK
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HEY1 Polyclonal antibody specifically detects HEY1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| HEY1 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing, Neuroscience, Transcription Factors and Regulators | |
| PBS (pH 7.3), 50% glycerol | |
| 23462 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| basic helix-loop-helix protein OAF1, BHLHb31, Cardiovascular helix-loop-helix factor 2, CHF-2, CHF2hHRT1, Class B basic helix-loop-helix protein 31, Hairy and enhancer of split-related protein 1, hairy/enhancer-of-split related with YRPW motif 1, hairy/enhancer-of-split related with YRPW motif protein 1, Hairy-related transcription factor 1, HERP2HES-related repressor protein 1, HESR-1, HESR1MGC1274, HES-related repressor protein 2, HRT1, HRT-1OAF1 | |
| A synthetic peptide corresponding to a sequence within amino acids 114-129 of human HEY1 (NP_001269780.1).,, Sequence:, IIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title