missing translation for 'onlineSavingsMsg'
Learn More

Hemoglobin beta Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Product Code. 30498344 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
30498344 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498344 Supplier Novus Biologicals Supplier No. NBP335330APC
 Restricted Item
Estimated Shipment: 14-10-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

Hemoglobin beta Polyclonal antibody specifically detects Hemoglobin beta in Human,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Hemoglobin beta
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate APC
Formulation PBS
Gene Alias beta globin chain, beta-globin, CD113t-C, HBBB, HBD, Hemoglobin beta chain, hemoglobin subunit beta, hemoglobin, beta
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 47-147 of human Hemoglobin beta (NP_000509.1).,, Sequence:, GDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3043
Target Species Human, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.