missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HCAP-G (Human) Recombinant Protein
Human HCAP-G partial ORF ( AAH00827, 336 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00064151-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
Specifications
| AAH00827 | |
| non-SMC condensin I complex, subunit G | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NCAPG | |
| GST |
| 64151 | |
| Wheat germ expression system | |
| 25 μg | |
| CAPG, CHCG, FLJ12450, HCAP-G, MGC126525, NY-MEL-3 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |