missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ HCAP-G (Human) Recombinant Protein

Human HCAP-G partial ORF ( AAH00827, 336 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00064151-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16123443

  • 6245.00 NOK / 25µg
Estimated Shipment: 13-06-2024
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
Specifications

Specifications

AAH00827
non-SMC condensin I complex, subunit G
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NCAPG
GST
64151
Wheat germ expression system
25 μg
CAPG, CHCG, FLJ12450, HCAP-G, MGC126525, NY-MEL-3
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers