missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ HCAP-G (Human) Recombinant Protein
Human HCAP-G partial ORF ( AAH00827, 336 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.
4115.00 NOK - 6245.00 NOK
Specifications
| Accession Number | AAH00827 |
|---|---|
| Gene ID (Entrez) | 64151 |
| Name | non-SMC condensin I complex, subunit G |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
16113443
|
Abnova™
H00064151-Q01.10UG |
10 μg |
4115.00 NOK
10µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
|
16123443
|
Abnova™
H00064151-Q01.25UG |
25 μg |
6245.00 NOK
25µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
- Sequence: TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS
Specifications
| AAH00827 | |
| non-SMC condensin I complex, subunit G | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| CAPG, CHCG, FLJ12450, HCAP-G, MGC126525, NY-MEL-3 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 64151 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NCAPG | |
| GST |