missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ HCAP-G (Human) Recombinant Protein

Abnova™ HCAP-G (Human) Recombinant Protein

Product Code. 16123443
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Product Code. Quantity unitSize
16123443 25 μg 25µg
16113443 10 μg 10µg
2 options
This item is not returnable. View return policy

Product Code. 16123443

Brand: Abnova™ H00064151Q01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Human HCAP-G partial ORF ( AAH00827, 336 a.a. - 435 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: TTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVPEPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS

Specifications

Accession Number AAH00827
Gene ID (Entrez) 64151
Name non-SMC condensin I complex, subunit G
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 25 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias CAPG, CHCG, FLJ12450, HCAP-G, MGC126525, NY-MEL-3
Gene Symbol NCAPG
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.