Learn More
Abnova™ HAMP Recombinant Protein
Human HAMP full-length ORF (AAH20612, 25 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal
Brand: Abnova™ H00057817-P01.25ug
Additional Details : Weight : 0.00010kg
Description
The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity.
- Molecular weight: 32.34kDa
- Preparation method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8 in the elution buffer
- Quality Control Testing: 12.5% SDS-PAGE stained with Coomassie Blue
Sequence:
SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Best use within three months from the date of receipt of this protein.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH20612 | |
Solution | |
57817 | |
HAMP (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HAMP | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
32.34 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT | |
HEPC/HEPCIDIN/HFE2B/LEAP-1/LEAP1/PLTR | |
HAMP | |
Wheat Germ (in vitro) | |
GST |