missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ GTF2H2 (Human) Recombinant Protein
Description
- Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKLVLYIMYN
Specifications
Specifications
| Accession Number | AAH05345 |
| Gene ID (Entrez) | 2966 |
| Name | general transcription factor IIH, polypeptide 2, 44kDa |
| Preparation Method | Wheat germ expression system |
| Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
| Quantity | 25 μg |
| Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Gene Alias | BTF2, BTF2P44, MGC102806, T-BTF2P44, TFIIH |
| Gene Symbol | GTF2H2 |
| Species | Wheat Germ (in vitro) |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?