missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ GTF2H2 (Human) Recombinant Protein

Abnova™ GTF2H2 (Human) Recombinant Protein

Product Code. 16125901
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Product Code. Quantity unitSize
16125901 25 μg 25µg
16115901 10 μg 10µg
2 options
This item is not returnable. View return policy

Product Code. 16125901

Brand: Abnova™ H00002966P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Human GTF2H2 full-length ORF ( AAH05345, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKKAVDMTCHGEPSLYNSLSIAMQTLKLVLYIMYN

Specifications

Accession Number AAH05345
Gene ID (Entrez) 2966
Name general transcription factor IIH, polypeptide 2, 44kDa
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 25 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias BTF2, BTF2P44, MGC102806, T-BTF2P44, TFIIH
Gene Symbol GTF2H2
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.