missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500445

Glycogenin 1 Antibody [Allophycocyanin], Novus Biologicals Biologicals™

Product Code. 30500445 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
Product Code. Quantity unitSize
30500445 0.1 mL 0.1mL
1 options
This item is not returnable. View return policy

Product Code. 30500445

Brand: Novus Biologicals NBP335107APC

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Glycogenin 1 Polyclonal antibody specifically detects Glycogenin 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Glycogenin 1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate APC
Formulation PBS
Gene Alias EC 2.4.1.186, glycogenin, glycogenin 1, glycogenin-1, GN1, GN-1, GSD15, GYG
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 234-333 of human Glycogenin 1 (NP_001171649.1).,, Sequence:, EAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 2992
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.