missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GH2 (Human) Recombinant Protein

Human GH2 full-length ORF ( AAH20760.1, 27 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002689-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135441

  • 3602.46 NOK / 10µg

Estimated Shipment: 21-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: FPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEAYILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLRSVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Specifications

Specifications

AAH20760.1
growth hormone 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GH2
GST
2689
Wheat germ expression system
10 μg
GH-V, GHL, GHV, hGH-V
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates