missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500496

GBF1 Antibody [DyLight 650], Novus Biologicals Biologicals™

Product Code. 30500496 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500496 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500496 Supplier Novus Biologicals Supplier No. NBP335248C

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

GBF1 Polyclonal antibody specifically detects GBF1 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen GBF1
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate DyLight 650
Formulation 50mM Sodium Borate
Gene Alias ARF1GEF, BFA-resistant GEF 1, FLJ21263, golgi brefeldin A resistant guanine nucleotide exchange factor 1, golgi-specific brefeldin A resistance factor 1, Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1, KIAA0248FLJ21500, MGC134877, MGC134878
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1).,, Sequence:, MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8729
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.