missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ GALK1 (Human) Recombinant Protein

Human GALK1 full-length ORF ( AAH01166, 1 a.a. - 392 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002584-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16195291

  • 3655.00 NOK / 10µg
Estimated Shipment: 27-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
Specifications

Specifications

AAH01166
galactokinase 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GALK1
GST
2584
Wheat germ expression system
10 μg
GALK, GK1
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers