missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30498628

GADD45G Antibody [Alexa Fluor« 488], R&D Systems™

Artikelnummer. 30498628 Alle ansehen Bio Techne Produkte
Ansicht ändern
Click to view available options
Quantity:
0.1 mL
Packungsgröße:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity Packungsgröße
30498628 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30498628 Lieferant Novus Biologicals Lieferanten-Nr. NBP335120AF488
 Restricted Item
Estimated Shipment: 13-11-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

GADD45G Polyclonal antibody specifically detects GADD45G in Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen GADD45G
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 488
Formulation 50mM Sodium Borate
Gene Alias CR6DNA damage-inducible transcript 2 protein, Cytokine-responsive protein CR6, DDIT-2, DDIT2GADD45-gamma, growth arrest and DNA damage-inducible protein GADD45 gamma, growth arrest and DNA-damage-inducible, gamma, GRP1717 kD
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 90-159 of human GADD45G (NP_006696.1).,, Sequence:, IDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10912
Target Species Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.