missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FSTL1 (Human) Recombinant Protein
Human FSTL1 partial ORF ( NP_009016.1, 209 a.a. - 306 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00011167-Q01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: ADWKLSFQEFLKCLNPSFNPPEKKCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTKRVSTK
Specifications
| NP_009016.1 | |
| follistatin-like 1 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FSTL1 | |
| GST |
| 11167 | |
| Wheat germ expression system | |
| 10 μg | |
| FLJ50214, FLJ52277, FRP, FSL1 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |