missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FOSL2 (Human) Recombinant Protein

Human FOSL2 full-length ORF ( AAH08899, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00002355-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16125131

Estimated Shipment: 19-09-2024
to see stock.

Description

Sequence: MSVGLDLPQMLPGSPSPSLKEAFAEDGEAGEGGGRPSLEWRLQQLLPQHPLSLSWLLTSPQGTGPFLPSVVICHLLDQVLSLLHSPVPTPVHSSGPGSKQAVNSWPELSLWLVAHAPFLVVC

Specifications

Accession Number	AAH08899
Name	FOS-like antigen 2
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	FOSL2
Protein Tag	GST

Gene ID (Entrez)	2355
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	FLJ23306, FRA2
Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Product Suggestions

Description