missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
FNDC4 Polyclonal antibody specifically detects FNDC4 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | FNDC4 |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 594 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | fibronectin type III domain containing 4, fibronectin type III domain-containing protein 4, Fibronectin type III repeat-containing protein 1, FRCP1FLJ22362 |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 45-167 of human FNDC4 (NP_073734.1).,, Sequence:, DRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQT |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?