missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FKBP1A (Human) Recombinant Protein

Human FKBP1A full-length ORF ( AAH05147, 1 a.a. - 108 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002280-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16135011

  • 3602.46 NOK / 10µg

Estimated Shipment: 20-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Specifications

Specifications

AAH05147
FK506 binding protein 1A, 12kDa
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FKBP1A
GST
2280
Wheat germ expression system
10 μg
FKBP-12, FKBP1, FKBP12, FKBP12C, PKC12, PKCI2, PPIASE
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates