missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FBXW11 Recombinant Protein
Brand: Abnova™ H00023291-P01.25ug
Additional Details : Weight : 0.00010kg
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH26213 | |
| Solution | |
| 23291 | |
| FBXW11 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FBXW11 | |
| Human | |
| Yes |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 83.93 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR | |
| BTRC2/BTRCP2/FBW1B/FBXW1B/Fbw11/Hos/KIAA0696 | |
| FBXW11 | |
| Wheat Germ (in vitro) | |
| GST |
Safety and Handling
Product Identifier
Signal Word
Hazard Category
Hazard Statement
Precautionary Statement
Supplemental information
- FBXW11 (Human) Recombinant Protein (P01)
Signal Word
- Warning
Hazard Category
- Acute toxicity Category 4
- Serious eye damage/eye irritation Category 2
- Skin corrosion/irritation Category 2
Hazard Statement
- H302-Harmful if swallowed.
- H312-Harmful in contact with skin.
- H319-Causes serious eye irritation.
Precautionary Statement
- P102-Keep out of reach of children.
- P103-Read label before use.
- P233-Keep container tightly closed.
- P264-Wash hands thoroughly after handling.
- P270-Do not eat, drink or smoke when using this product.
- P280-Wear protective gloves/protective clothing/eye protection/face protection.
- P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
- P303+P361+P353-IF ON SKIN (or hair): Take off immediately all contaminated clothing. Rinse skin with water/ shower.
- P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
- P404-Store in a closed container.
- P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.
Supplemental information
- MIXTURE LIST-Contains : tris-HCl, reduced glutathione