missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FBXO45 (Human) Recombinant Protein

Human FBXO45 partial ORF ( XP_117294.3, 39 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00200933-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16142397

  • 6270.00 NOK / 25µg
Estimated Shipment: 02-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: LPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKI
Specifications

Specifications

XP_117294.3
F-box protein 45
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FBXO45
GST
200933
Wheat germ expression system
25 μg
Fbx45
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers