missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ FABP7 (Human) Recombinant Protein

Human FABP7 full-length ORF ( AAH12299, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002173-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134821

  • 5420.23 NOK / 25µg

Estimated Shipment: 17-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Specifications

Specifications

AAH12299
fatty acid binding protein 7, brain
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FABP7
GST
2173
Wheat germ expression system
25 μg
B-FABP, BLBP, DKFZp547J2313, FABPB, MRG
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates