missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ FABP7 (Human) Recombinant Protein
Human FABP7 full-length ORF ( AAH12299, 1 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00002173-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Specifications
| AAH12299 | |
| fatty acid binding protein 7, brain | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FABP7 | |
| GST |
| 2173 | |
| Wheat germ expression system | |
| 25 μg | |
| B-FABP, BLBP, DKFZp547J2313, FABPB, MRG | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |