missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EVI2A (Human) Recombinant Protein

Human EVI2A full-length ORF ( AAH35572, 25 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00002123-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134721

  • 5420.23 NOK / 25µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
Specifications

Specifications

AAH35572
ecotropic viral integration site 2A
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EVI2A
GST
2123
Wheat germ expression system
25 μg
EVDA, EVI2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates