missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. MSH2 Antibody, R&D Systems™

MSH2 Antibody, R&D Systems™

Product Code. 18610379 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18610379 100 μg 100µL
18607298 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18610379 Supplier Novus Biologicals Supplier No. NBP268845
 Restricted Item
Estimated Shipment: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

MSH2 Polyclonal antibody specifically detects MSH2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen MSH2
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias COCA1, DNA mismatch repair protein Msh2, FCC1, hMSH2, HNPCC, HNPCC1mutS (E. coli) homolog 2 (colon cancer, nonpolyposis type 1), LCFS2, mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli), MutS protein homolog 2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
Purification Method Protein A purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Core ESC Like Genes, DNA Repair, Mismatch Repair, Stem Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 4436
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.