missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ERK5/BMK1 Antibody, R&D Systems™

ERK5/BMK1 Antibody, R&D Systems™

Product Code. 18606286 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
25µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18606286 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18606286 Supplier Novus Biologicals Supplier No. NBP25836925ul
 Restricted Item
Estimated Shipment: 01-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

ERK5/BMK1 Polyclonal specifically detects ERK5/BMK1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen ERK5/BMK1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias Big MAP kinase 1, BMK-1, BMK1 kinase, BMK1EC 2.7.11.24, EC 2.7.11, ERK-5, ERK5MAPK 7, Extracellular signal-regulated kinase 5, extracellular-signal-regulated kinase 5, MAP kinase 7, mitogen-activated protein kinase 7, PRKM7ERK4
Gene Symbols MAPK7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5598
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.