missing translation for 'onlineSavingsMsg'
Learn More

EAAT3 Antibody [Alexa Fluor« 594], Novus Biologicals Biologicals™

Product Code. 30498913 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498913 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498913 Supplier Novus Biologicals Supplier No. NBP338021AF594

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

EAAT3 Polyclonal antibody specifically detects EAAT3 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen EAAT3
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 594
Formulation 50mM Sodium Borate
Gene Alias EAAC1excitatory amino acid carrier 1, EAAT3excitatory amino acid transporter 3, Excitatory amino-acid carrier 1, Neuronal and epithelial glutamate transporter, Sodium-dependent glutamate/aspartate transporter 3, solute carrier family 1 (neuronal/epithelial high affinity glutamatetransporter, system Xag), member 1, Solute carrier family 1 member 1
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 430-524 of human EAAT3 (NP_004161.4).,, Sequence:, SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline ABC Transporters, Cell Biology, Cell Cycle and Replication, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 6505
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.