missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 30500595

E2F8 Antibody [Alexa Fluor« 405], Novus Biologicals Biologicals™

Product Code. 30500595 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30500595 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30500595 Supplier Novus Biologicals Supplier No. NBP335168AF405

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

E2F8 Polyclonal antibody specifically detects E2F8 in Human,Mouse samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen E2F8
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Alexa Fluor 405
Formulation 50mM Sodium Borate
Gene Alias E2F family member 8, E2F transcription factor 8, E2F-8, FLJ23311, transcription factor E2F8
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 788-867 of human E2F8 (NP_078956.2).,, Sequence:, PVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMDFEGANKTSLGTLFVPQRKLEVSTEDVH
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 79733
Target Species Human, Mouse
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.