missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ E2F3 (Human) Recombinant Protein
Human E2F3 full-length ORF ( AAH16847, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00001871-P01.10ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
Specifications
| AAH16847 | |
| E2F transcription factor 3 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| E2F3 | |
| GST |
| 1871 | |
| Wheat germ expression system | |
| 10 μg | |
| DKFZp686C18211, E2F-3, KIAA0075, MGC104598 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |