missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ E2F3 (Human) Recombinant Protein

Human E2F3 full-length ORF ( AAH16847, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001871-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16134291

  • 3602.46 NOK / 10µg

Estimated Shipment: 10-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLPSHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAFPHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
Specifications

Specifications

AAH16847
E2F transcription factor 3
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
E2F3
GST
1871
Wheat germ expression system
10 μg
DKFZp686C18211, E2F-3, KIAA0075, MGC104598
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates