Abnova™ DNAL4 Recombinant Protein

Name: Abnova&trade; DNAL4 Recombinant Protein
Brand: Abnova&trade;
SKU: 16104532
Price: 6245.00 EUR

Marke: Abnova™ H00010126-P01.25ug

Weitere Details : Weight : 0.00010kg

Artikelnummer. 16104532

Estimated Shipment: 01-07-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Accession Number	AAH02968
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	37.29
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Gene Alias	PIG27
Gene Symbol	DNAL4
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	10126
Name	DNAL4 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	DNAL4
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Produktvorschläge

Beschreibung