missing translation for 'onlineSavingsMsg'
Learn More

DNAJC19 Antibody [mFluor Violet 610 SE], R&D Systems™

Product Code. 30498423 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
30498423 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498423 Supplier Novus Biologicals Supplier No. NBP338125MFV610
 Restricted Item
Estimated Shipment: 12-10-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

DNAJC19 Polyclonal antibody specifically detects DNAJC19 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen DNAJC19
Applications ELISA, Western Blot, Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate mFluor Violet 610 SE
Formulation 50mM Sodium Borate
Gene Alias DnaJ (Hsp40) homolog, subfamily C, member 19, DnaJ homolog subfamily C member 19, homolog of yeast TIM14, mitochondrial import inner membrane translocase subunit TIM14, Tim14, TIMM14TIM14Pam18
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DNAJC19 (NP_660304.1).,, Sequence:, MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Vision
Primary or Secondary Primary
Gene ID (Entrez) 131118
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.