missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DDT (Human) Recombinant Protein

Human DDT full-length ORF ( AAH05971, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001652-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16133981

  • 6270.00 NOK / 25µg
Estimated Shipment: 06-12-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
Specifications

Specifications

AAH05971
D-dopachrome tautomerase
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DDT
GST
1652
Wheat germ expression system
25 μg
DDCT
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers