missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ DDIT3 (Human) Recombinant Protein

Product Code. 16127017
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16127017 25 μg 25µg
16117017 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 16127017 Supplier Abnova™ Supplier No. H00001649P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Human DDIT3 full-length ORF ( AAH03637.1, 1 a.a. - 169 a.a.) recombinant protein with GST-tag at N-terminal.

  • Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA

Specifications

Accession Number AAH03637.1
Gene ID (Entrez) 1649
Name DNA-damage-inducible transcript 3
Preparation Method Wheat germ expression system
Quality Control Testing 125% SDS-PAGE Stained with Coomassie Blue
Quantity 25 μg
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias CEBPZ, CHOP, CHOP10, GADD153, MGC4154
Gene Symbol DDIT3
Species Wheat Germ (in vitro)
Protein Tag GST
Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.