missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
DAZL Polyclonal antibody specifically detects DAZL in Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | DAZL |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Alexa Fluor 532 |
| Formulation | 50mM Sodium Borate |
| Gene Alias | DAZHSPGY-like-autosomal, DAZL1DAZ-like autosomal, DAZLA, deleted in azoospermia-like, Deleted in azoospermia-like 1, germline specific RNA binding protein, MGC26406, spermatogenesis gene on the Y-like autosomal, SPGYLADAZ homolog |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2).,, Sequence:, RSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
| Purification Method | Affinity purified |
| Quantity | 0.1 mL |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?