missing translation for 'onlineSavingsMsg'
Learn More

CYBB/NOX2 Antibody [DyLight 650], Novus Biologicals Biologicals™

Product Code. 30498666 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30498666 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30498666 Supplier Novus Biologicals Supplier No. NBP335663C

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

CYBB/NOX2 Polyclonal antibody specifically detects CYBB/NOX2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen CYBB/NOX2
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate DyLight 650
Formulation 50mM Sodium Borate
Gene Alias CGD, CGD91-phox, Cytochrome b(558) subunit beta, cytochrome b-245 heavy chain, cytochrome b-245, beta polypeptide, Cytochrome b558 subunit beta, EC 1.6.3, GP91-1, GP91PHOX, GP91-PHOX, Heme-binding membrane glycoprotein gp91phox, NADPH oxidase 2, Neutrophil cytochrome b 91 kDa polypeptide, NOX2chronic granulomatous disease, p22 phagocyte B-cytochrome, p91-PHOX, Superoxide-generating NADPH oxidase heavy chain subunit
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 385-570 of human CYBB/NOX2 (NP_000388.2).,, Sequence:, FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 1536
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.