missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CSF2RA (Human) Recombinant Protein

Human CSF2RA full-length ORF ( AAH02635.1, 1 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00001438-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16193591

  • 5540.00 NOK / 25µg
Estimated Shipment: 23-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Specifications

Specifications

AAH02635.1
colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CSF2RA
GST
1438
Wheat germ expression system
25 μg
CD116, CDw116, CSF2R, CSF2RAX, CSF2RAY, CSF2RX, CSF2RY, GM-CSF-R-alpha, GMCSFR, GMR, MGC3848, MGC4838
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers