missing translation for 'onlineSavingsMsg'
Learn More

Craniofacial Development Protein 1 Antibody (5B7), Novus Biologicals™

Mouse Monoclonal Antibody

Brand: Novus Biologicals H00010428-M04

Product Code. 18329638

5408.07 NOK / 0.01mg

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Craniofacial Development Protein 1 Monoclonal antibody specifically detects Craniofacial Development Protein 1 in Human samples. It is validated for Western Blot, ELISA

Specifications

Antigen	Craniofacial Development Protein 1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	In 1x PBS, pH 7.4
Gene Alias	BCNTBUCENTAUR, Bucentaur, CP27phosphoprotein (Bucentaur), craniofacial development protein 1, p97, SWC5, Yeti
Immunogen	CFDP1 (NP_006315, 168 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESF
Quantity	0.1 mg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot, ELISA
Clone	5B7
Dilution	Western Blot 1:500, ELISA
Gene Accession No.	NP_006315
Host Species	Mouse
Purification Method	IgG purified
Regulatory Status	RUO
Gene ID (Entrez)	10428
Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Isotype	IgG1 κ

Product Suggestions

Craniofacial Development Protein 1 Antibody (5B7), Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Special Offers