missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Craniofacial Development Protein 1 Antibody (5B7), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00010428-M04
This item is not returnable.
View return policy
Description
Craniofacial Development Protein 1 Monoclonal antibody specifically detects Craniofacial Development Protein 1 in Human samples. It is validated for Western Blot, ELISA
Specifications
| Craniofacial Development Protein 1 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| BCNTBUCENTAUR, Bucentaur, CP27phosphoprotein (Bucentaur), craniofacial development protein 1, p97, SWC5, Yeti | |
| CFDP1 (NP_006315, 168 a.a. ~ 251 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESF | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA | |
| 5B7 | |
| Western Blot 1:500, ELISA | |
| NP_006315 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 10428 | |
| Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. | |
| IgG1 κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction