missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CPT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
1930.00 NOK - 5280.00 NOK
Specifications
| Antigen | CPT2 |
|---|---|
| Dilution | Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231535
|
Novus Biologicals
NBP3-38018-100ul |
100 μL |
5280.00 NOK
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229809
|
Novus Biologicals
NBP3-38018-20ul |
20 μL |
1930.00 NOK
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CPT2 Polyclonal antibody specifically detects CPT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)Specifications
| CPT2 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 1376 | |
| IgG | |
| Affinity purified |
| Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE | |
| A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title