missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. COX7A1 Antibody - Azide and BSA Free, R&D Systems™

COX7A1 Antibody - Azide and BSA Free, R&D Systems™

Product Code. 18603710 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18603710 0.1 mL 0.10mL
18631621 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18603710 Supplier Novus Biologicals Supplier No. NBP2921850.1ml
 Restricted Item
Estimated Shipment: 03-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

COX7A1 Polyclonal specifically detects COX7A1 in Human, Mouse, Rat samples. It is validated for ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Spécification

Antigen COX7A1
Applications ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS with 50% glycerol, pH7.3.
Gene Alias COX7AHCOX7A, COX7AM, cytochrome c oxidase subunit VIIa heart/muscle isoform, cytochrome c oxidase subunit VIIa polypeptide 1 (muscle), Cytochrome c oxidase subunit VIIa-H, Cytochrome c oxidase subunit VIIa-M, Cytochrome c oxidase subunit VIIa-muscle, mitochondrial
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-79 of human COX7A1 (NP_001855.1). MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 1346
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Product Type Antibody
Form Purified
Isotype IgG
Product Line Novus
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.