missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ COPS8 (Human) Recombinant Protein

Human COPS8 full-length ORF ( AAH03090, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00010920-P01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16195852

  • 3655.00 NOK / 10µg
Estimated Shipment: 20-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Specifications

Specifications

AAH03090
COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COPS8
GST
10920
Wheat germ expression system
10 μg
COP9, CSN8, MGC1297, MGC43256, SGN8
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers