missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Complement Component C1rLP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-88314
This item is not returnable.
View return policy
Description
Complement Component C1rLP Polyclonal specifically detects Complement Component C1rLP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Complement Component C1rLP | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500 | |
| C1RL1complement C1r subcomponent-like protein, C1r-like protein, C1r-like serine protease analog protein, C1r-LPcomplement C1r-like proteinase, C1RLPEC 3.4.21.-, CLSPa, complement component 1, r subcomponent-like, EC 3.4.21, EC 3.4.21.41 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 51279 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C1RL | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction