missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CLIC1 Recombinant Protein
CLIC1 ( AAH64527.1, 1-242aa) full-length recombinant protein with GST tag
Brand: Abnova™ H00001192-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
- MW: 52.6kDa
- Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH = 8 in elution buffer
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
| AAH64527.1 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 52.25 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 10 ug | |
| MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK | |
| G6/NCC27 | |
| CLIC1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 1192 | |
| CLIC1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CLIC1 | |
| Human | |
| Recombinant | |
| Solution |