Learn More
Abnova™ CLIC1 Recombinant Protein
CLIC1 ( AAH64527.1, 1-242aa) full-length recombinant protein with GST tag
Brand: Abnova™ H00001192-P01.10ug
Additional Details : Weight : 0.00010kg
Description
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.
- MW: 52.6kDa
- Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH = 8 in elution buffer
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH64527.1 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
52.25 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK | |
G6/NCC27 | |
CLIC1 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
1192 | |
CLIC1 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CLIC1 | |
Human | |
Recombinant | |
Solution |